PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D10G0506
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 336aa    MW: 37020.4 Da    PI: 8.3652
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D10G0506genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.22.3e-32185241158
    CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  dep+YVNaKQyq+Il+RRq Rakle+++kl +k rkpylheSRh hAl+R+Rg+gGrF
  Gh_D10G0506 185 DEPIYVNAKQYQAILRRRQYRAKLEAQNKL-IKVRKPYLHESRHLHALKRARGNGGRF 241
                  79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.1E-36183244IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.012184244IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.5E-26186241IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.8E-23187209IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860189209IPR018362CCAAT-binding factor, conserved site
PRINTSPR006167.8E-23218241IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MQNKKNSAVS SHSMSTYVVG CSSWENSTES HVQHSSISEN LSLKMGLLPQ YLNNNKQLSF  60
QFQDQDSSST QSTCQSYPEV GSAGDSNLYE QSLISASSGG NEMHGKLVGD HTKLAAPMGT  120
QECVLPPSQV DYSKSIAHIP LHYADPYFGG VVASAYTPLA MQIHHQLTMA MLPARVPLPL  180
ELTRDEPIYV NAKQYQAILR RRQYRAKLEA QNKLIKVRKP YLHESRHLHA LKRARGNGGR  240
FLNTKKLQES KESKGITTSN GLDTCFSKSE VHQLENYKDA ASTASCSDVT TASNSDEIFQ  300
QPDFRFSTYS SHIGGPMPGH TGDMQGGGNL HHRLCG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-19185246263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.193081e-128boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012454937.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
TrEMBLA0A0D2UN210.0A0A0D2UN21_G
STRINGGLYMA07G04050.58e-97(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33492762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.12e-76nuclear factor Y, subunit A3